PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C010833P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 297aa    MW: 32475.4 Da    PI: 9.4227
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C010833P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.95.6e-191257147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEde l+++v+ +G+++W++I++ ++ gR++k+c++rw + 
   MELO3C010833P1 12 KGPWSPEEDESLKRLVESYGPRNWSLISKSIP-GRSGKSCRLRWCNQ 57
                     79******************************.***********985 PP

2Myb_DNA-binding569.3e-1866108347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+eEd+ +++a++++G++ W+tIar ++ gRt++ +k++w++ 
   MELO3C010833P1  66 PFTAEEDDAIIRAHAKFGNK-WATIARLLN-GRTDNAIKNHWNST 108
                      89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.278762IPR017930Myb domain
SuperFamilySSF466893.74E-329105IPR009057Homeodomain-like
SMARTSM007176.3E-171160IPR001005SANT/Myb domain
PfamPF002491.3E-181257IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-261365IPR009057Homeodomain-like
CDDcd001671.50E-161456No hitNo description
SMARTSM007178.8E-1663111IPR001005SANT/Myb domain
PROSITE profilePS5129421.84564113IPR017930Myb domain
CDDcd001673.99E-1366109No hitNo description
PfamPF002493.7E-1566108IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.6E-2466112IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MDSVGKNVDR IKGPWSPEED ESLKRLVESY GPRNWSLISK SIPGRSGKSC RLRWCNQLSP  60
QVEHRPFTAE EDDAIIRAHA KFGNKWATIA RLLNGRTDNA IKNHWNSTLK RKCSAMGDDF  120
NDPDLHHPPK RSASVGPSPV TVASGFGLNP SSPSGSDLSD SSPPPPPQPV YRPLARSSSI  180
VPSNQQQQQQ QQQIVNSYDP PTSLCLSLPG SNSKSGYGSD SIPSPTRNMV QATTPTAGGH  240
GKESELFSAE FLSAMQEMIK IEVRKYMSGI EHNGWHLHTD AIRNAVVKRM GISKID*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C5e-40111133105C-Myb DNA-Binding Domain
1mse_C5e-40111133105C-Myb DNA-Binding Domain
1gv2_A5e-40111133105MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-39711353159MYB PROTO-ONCOGENE PROTEIN
1h88_C2e-39711353159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818230.0LN681823.1 Cucumis melo genomic scaffold, anchoredscaffold00014.
GenBankLN7132570.0LN713257.1 Cucumis melo genomic chromosome, chr_3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008444592.10.0PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW12e-86MYB44_ARATH; Transcription factor MYB44
TrEMBLR4QSR30.0R4QSR3_CUCME; MYB transcription factor
STRINGPOPTR_0002s12410.11e-128(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF84334124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.12e-78myb domain protein 73